KCTD5 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of human colon cancer using 85210-4-RR (same clone as 85210-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85210-4-RR (KCTD5 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85210-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 85210-4-RR (same clone as 85210-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85210-4-RR (KCTD5 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85210-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 85210-4-RR (same clone as 85210-4-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using KCTD5 antibody (85210-4-RR, Clone: 242864A11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85210-4-PBS in a different storage buffer formulation.

KCTD5 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 85210-4-PBS

Clone No.242864A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

242864A11, BTB/POZ domain-containing protein KCTD5, KCTD17, KCTD2

---

Product Information

85210-4-PBS targets KCTD5 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7915

  Product name: Recombinant human KCTD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC007314

  Sequence: MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM

• Full Name: potassium channel tetramerisation domain containing 5
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: BC007314
• Gene Symbol: KCTD5
• Gene ID (NCBI): 54442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NXV2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KCTD5 belongs to the human potassium (K+) channel tetramerization domain (KCTD) family of proteins which share sequence similarity with the cytoplasmic domain of voltage-gated K+ channels (Kv channels). The KCTD proteins have relatively conserved N-terminal domains and variable C-termini (PMID: 24268103). KCTD5 interacts with cullin3 and has been proposed to function as substrate adapter for cullin3 based ubiquitin E3 ligases (PMID: 26188516).