KCTD5 Recombinant monoclonal antibody

• 

  IHC staining of human colon cancer using 85210-4-RR

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 85210-4-RR (KCTD5 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 85210-4-RR

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 85210-4-RR (KCTD5 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 85210-4-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using KCTD5 antibody (85210-4-RR, Clone: 242864A11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

KCTD5 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, ELISA

Cat No. 85210-4-RR

Clone No.242864A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

242864A11, BTB/POZ domain-containing protein KCTD5, KCTD17, KCTD2

---

Tested Applications

• Positive IHC detected in: human ovary cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85210-4-RR targets KCTD5 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7915

  Product name: Recombinant human KCTD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC007314

  Sequence: MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM

• Full Name: potassium channel tetramerisation domain containing 5
• Calculated Molecular Weight: 26 kDa
• GenBank Accession Number: BC007314
• Gene Symbol: KCTD5
• Gene ID (NCBI): 54442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NXV2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KCTD5 belongs to the human potassium (K+) channel tetramerization domain (KCTD) family of proteins which share sequence similarity with the cytoplasmic domain of voltage-gated K+ channels (Kv channels). The KCTD proteins have relatively conserved N-terminal domains and variable C-termini (PMID: 24268103). KCTD5 interacts with cullin3 and has been proposed to function as substrate adapter for cullin3 based ubiquitin E3 ligases (PMID: 26188516).