KCTD5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85210-5-RR (same clone as 85210-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85210-5-RR (KCTD5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85210-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85210-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85210-5-RR against Human KCTD5 were performed. The affinity constant is 1.01 nM.

KCTD5 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85210-5-PBS

Clone No.242864E2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

242864E2, BTB/POZ domain-containing protein KCTD5, KCTD17, KCTD2

---

Product Information

85210-5-PBS targets KCTD5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7915

  Product name: Recombinant human KCTD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC007314

  Sequence: MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM

• Full Name: potassium channel tetramerisation domain containing 5
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC007314
• Gene Symbol: KCTD5
• Gene ID (NCBI): 54442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NXV2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KCTD5 belongs to the human potassium (K+) channel tetramerization domain (KCTD) family of proteins which share sequence similarity with the cytoplasmic domain of voltage-gated K+ channels (Kv channels). The KCTD proteins have relatively conserved N-terminal domains and variable C-termini (PMID: 24268103). KCTD5 interacts with cullin3 and has been proposed to function as substrate adapter for cullin3 based ubiquitin E3 ligases (PMID: 26188516).