KIAA1199 / CEMIP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIAA1199 / CEMIP Polyclonal antibody, PBS Only (31106-1-PBS)

• 

  WB analysis using 31106-1-AP (same clone as 31106-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31106-1-AP (KIAA1199 / CEMIP antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31106-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 31106-1-AP (same clone as 31106-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 31106-1-AP (KIAA1199 / CEMIP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31106-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 31106-1-AP (same clone as 31106-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using KIAA1199 / CEMIP antibody (31106-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31106-1-PBS in a different storage buffer formulation.

KIAA1199 / CEMIP Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31106-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

KIAA1199, CEMIP, Protein KIAA1199, HYBID, Hyaluronan binding protein involved in hyaluronan depolymerization

---

Product Information

31106-1-PBS targets KIAA1199 / CEMIP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34315

  Product name: Recombinant human KIAA1199 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-420 aa of BC020256

  Sequence: FERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSSSVEDHIEYHGHRGSAAARVFKLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAHPGKICNRPIDIQATTMDGVNLSTEVVYKKGQDYRFACYDRGRACRSYRVRFLCGKPVRPKLTVTIDTNVN

• Full Name: KIAA1199 / CEMIP
• Calculated Molecular Weight: 1361 aa, 153 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC020256
• Gene Symbol: KIAA1199
• Gene ID (NCBI): 57214
• RRID: AB_3669858
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WUJ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIAA1199, also known as CEMIP, was first discovered as an inner-ear protein whose genetic mutations were linked to nonsyndromic hearing loss. KIAA1199 is involved in hyaluronan degradation. Studies have shown that KIAA1199 is overexpressed in many types of cancers, suggesting a critical role of KIAA1199 in cancer progression.