KIF12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KIF12 Polyclonal antibody, PBS Only (12035-1-PBS)

• 

  WB analysis using 12035-1-AP (same clone as 12035-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12035-1-AP (KIF12 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12035-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 12035-1-AP (same clone as 12035-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 12035-1-AP (KIF12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12035-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 12035-1-AP (same clone as 12035-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12035-1-AP (KIF12 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12035-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 12035-1-AP (same clone as 12035-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 12035-1-AP (KIF12 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12035-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 12035-1-AP (same clone as 12035-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 12035-1-AP (KIF12 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12035-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 12035-1-AP (same clone as 12035-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 12035-1-AP (KIF12 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12035-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12035-1-AP (same clone as 12035-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12035-1-AP (KIF12 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12035-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12035-1-AP (same clone as 12035-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12035-1-AP (KIF12 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12035-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12035-1-AP (same clone as 12035-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12035-1-AP (KIF12 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12035-1-PBS in a different storage buffer formulation.

KIF12 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12035-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Kinesin like protein KIF12, Kinesin-like protein KIF12, RP11 56P10.3

---

Product Information

12035-1-PBS targets KIF12 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2707

  Product name: Recombinant human KIF12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-334 aa of BC010626

  Sequence: MQRTFAWLLDRVQHLGAPVTLRASYLEIYNEQVRDLLSLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAHTLNQASSRSHALLTLYISRQTAQQMPSVDPGEPPVGGKLCFVDLAGSEKVAATGSRGELMLEANSINRSLLALGHCISLLLDPQRKQSHIPFRDSKLTKLLADSLGGRGVTLMVACVSPSAQCLPETLSTLRYASRAQRVTTRPQAPKSPVAKQPQRLETEMLQLQEENRRLQFQLDQMDCKASGLSGARVAWAQRNLYGMLQEFMLENERLRKEKSQLQNSRDLAQNEQRILAQQVHALERRLLSA

• Full Name: kinesin family member 12
• Calculated Molecular Weight: 646 aa, 71 kDa
• Observed Molecular Weight: 55-70 kDa
• GenBank Accession Number: BC010626
• Gene Symbol: KIF12
• Gene ID (NCBI): 113220
• RRID: AB_2280813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96FN5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KIF12(kinesin family member 12) is a member of the kinesin superfamily (KIF), which is a microtubule-dependent ATP-driven molecular motor, and its core is involved in the regulation of organelle transport, cell division and metabolic enzyme degradation. Its functional defects are closely related to bile duct diseases, liver diseases and tumors.