• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated KIF2A Polyclonal antibody

KIF2A Polyclonal Antibody for IF/ICC

Cat No. CL488-27218

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

HK2, KIF2, KIF2A, Kinesin 2, kinesin heavy chain member 2A, Kinesin like protein KIF2A, KNS2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA549 cells, HeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-27218 targets KIF2A in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25692

Product name: Recombinant human KIF2A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 528-679 aa of BC031828

Sequence: VDPTAAGDVRPIMHHPPNQIDDLETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESIRWLEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL

Predict reactive species
Full Name kinesin heavy chain member 2A
Calculated Molecular Weight 679 aa, 77 kDa
Observed Molecular Weight 80 kDa~100 kDa
GenBank Accession NumberBC031828
Gene Symbol KIF2A
Gene ID (NCBI) 3796
RRIDAB_3672809
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00139
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Kinesin Family Member 2A (KIF2A), also known as Kinesin-2, is a member of the kinesin-13 superfamily protein. KIF2A is a microtubule-depolymerizing kinesin motor protein with essential roles in neural progenitor division and axonal pruning during brain development. KIF2A is involved in microtubule depolymerization at minus ends of the spindle to generate pole-migration forces for chromosome movement. KIF2A is a crucial factor in the invasion and metastasis of various tumors, such as gastric cancer(PMID: 32801897), hepatocellular carcinoma(PMID: 36277155).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 KIF2A antibody CL488-27218Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...