Product Information
87944-1-PBS targets KK-LC-1 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg5757 Product name: Recombinant human KKLC1 protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 22-113 aa of NM_001017978.3 Sequence: RRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST Predict reactive species |
| Full Name | chromosome X open reading frame 61 |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 13-16 kDa |
| GenBank Accession Number | NM_001017978.3 |
| Gene Symbol | KK-LC-1 |
| Gene ID (NCBI) | 203413 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q5H943 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
KK-LC-1 has been described as kita-kyushu lung cancer antigen 1, cancer/testis antigen 83. Therefore, KK-LC-1 is also known as CXorf61 and CT83. KK-LC-1 has been tested for association to diseases, such as adenocarcinoma and lung neoplasms. Studies have shown that KK-LC-1 is an ideal target for immunotherapy of triple-negative breast cancer (TNBC) (PMID: 26327325).



