KK-LC-1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• KK-LC-1 Recombinant monoclonal antibody, PBS Only (87944-1-PBS)

• 

  WB analysis using 87944-1-RR (same clone as 87944-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87944-1-RR (KK-LC-1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. KK-LC-1 deficient cell line HEK-293T was served as a negative control. This data was developed using the same antibody clone with 87944-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87944-1-RR (same clone as 87944-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87944-1-RR (KK-LC-1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87944-1-PBS in a different storage buffer formulation.

KK-LC-1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87944-1-PBS

Clone No.260139A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CXorf61, CT83, Kita-kyushu lung cancer antigen 1, KK LC 1, KKLC1

---

Product Information

87944-1-PBS targets KK-LC-1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5757

  Product name: Recombinant human KKLC1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-113 aa of NM_001017978.3

  Sequence: RRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

• Full Name: chromosome X open reading frame 61
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 13-16 kDa
• GenBank Accession Number: NM_001017978.3
• Gene Symbol: KK-LC-1
• Gene ID (NCBI): 203413
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5H943
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KK-LC-1 has been described as kita-kyushu lung cancer antigen 1, cancer/testis antigen 83. Therefore, KK-LC-1 is also known as CXorf61 and CT83. KK-LC-1 has been tested for association to diseases, such as adenocarcinoma and lung neoplasms. Studies have shown that KK-LC-1 is an ideal target for immunotherapy of triple-negative breast cancer (TNBC) (PMID: 26327325).