KK-LC-1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• KK-LC-1 Recombinant monoclonal antibody (87944-1-RR)

• 

  WB analysis using 87944-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87944-1-RR (KK-LC-1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. KK-LC-1 deficient cell line HEK-293T was served as a negative control.

• 

  WB analysis using 87944-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87944-1-RR (KK-LC-1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

KK-LC-1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87944-1-RR

Clone No.260139A2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CXorf61, CT83, Kita-kyushu lung cancer antigen 1, KK LC 1, KKLC1

---

Tested Applications

• Positive WB detected in: HeLa cells, SGC-7901 cells, MDA-MB-231 cells, U2OS cells, U266 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87944-1-RR targets KK-LC-1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5757

  Product name: Recombinant human KKLC1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-113 aa of NM_001017978.3

  Sequence: RRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

• Full Name: chromosome X open reading frame 61
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 13-16 kDa
• GenBank Accession Number: NM_001017978.3
• Gene Symbol: KK-LC-1
• Gene ID (NCBI): 203413
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5H943
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KK-LC-1 has been described as kita-kyushu lung cancer antigen 1, cancer/testis antigen 83. Therefore, KK-LC-1 is also known as CXorf61 and CT83. KK-LC-1 has been tested for association to diseases, such as adenocarcinoma and lung neoplasms. Studies have shown that KK-LC-1 is an ideal target for immunotherapy of triple-negative breast cancer (TNBC) (PMID: 26327325).