Use Able AI chat for product recommendations

KLHL7 Polyclonal antibody, PBS Only

KLHL7 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32697-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Kelch-like protein 7

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

32697-1-PBS targets KLHL7 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag38050

Product name: Recombinant human KLHL7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 291-586 aa of BC039585

Sequence: HDYRIALFGGSQPQSCRYFNPKDYSWTDIRCPFEKRRDAACVFWDNVVYILGGSQLFPIKRMDCYNVVKDSWYSKLGPPTPRDSLAACAAEGKIYTSGGSEVGNSALYLFECYDTRTESWHTKPSMLTQRCSHGMVEANGLIYVCGGSLGNNVSGRVLNSCEVYDPATETWTELCPMIEARKNHGLVFVKDKIFAVGGQNGLGGLDNVEYYDIKLNEWKMVSPMPWKGVTVKCAAVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVVDTCGANEETLET

Predict reactive species
Full Name kelch-like 7 (Drosophila)
Calculated Molecular Weight 586 aa, 66 kDa
Observed Molecular Weight65 kDa
GenBank Accession NumberBC039585
Gene Symbol KLHL7
Gene ID (NCBI) 55975
RRIDAB_3742714
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ8IXQ5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

KLHL7 (Kelch-like protein 7) is a member of the Kelch-like protein family and plays significant roles in various biological processes, including cell cycle regulation, protein degradation, and cytoskeleton organization. KLHL7 is highly expressed in various cancers and is associated with malignant progression and poor prognosis. In breast cancer, high expression of KLHL7 is linked to higher histological grades, estrogen receptor (ER)-negative or human epidermal growth factor receptor 2 (HER-2)-positive tumors, and triple-negative breast cancer (TNBC), and patients with high KLHL7 expression have shorter survival times. In gastric cancer, silencing KLHL7 gene expression can inhibit the proliferation, migration, and invasion of gastric cancer cells and has shown tumor-suppressive effects in in vivo models. Moreover, KLHL7 is highly expressed in colorectal cancer and ovarian cancer, among others, and is significantly associated with low patient survival rates.

Loading...
||
New chat

Able

正在加载,请稍候...