CoraLite®594-conjugated KLK11 Monoclonal antibody

KLK11 Monoclonal Antibody for FC (Intra)
Cat No. CL594-67427
Clone No.1E2B4

Host / Isotype

Mouse / IgG1

Reactivity

Human, Pig, Rat

Applications

FC (Intra)

Kallikrein 11, KLK11, PRSS20, Trypsin-like protease, UNQ649/PRO1279, Kallikrein11, Kallikrein-11, Kallikrein-11 inactive chain 1, Kallikrein-11 inactive chain 2, KLK 11, 1E2B4, EC:3.4.21.-

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells
Positive FC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67427 targets KLK11 in FC (Intra) applications and shows reactivity with Human, Pig, Rat samples.

Tested Reactivity Human, Pig, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29895

Product name: Recombinant human KLK11 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 58-250 aa of BC022068

Sequence: LTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN

Predict reactive species
Full Name kallikrein-related peptidase 11
Calculated Molecular Weight 250 aa, 27 kDa
Observed Molecular Weight 30-40 kDa
GenBank Accession NumberBC022068
Gene Symbol KLK11
Gene ID (NCBI) 11012
RRIDAB_3084765
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UBX7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

KLK11(Kallikrein-11) is also named as PRSS20, TLSP and belongs to the peptidase S1 family and Kallikrein subfamily. It is a multifunctinal protease cleaving several substrates for kallikrein and trypsin and involved in normal physiology processes in bronchus. This full length protein has a signal peptide, a propeptide and four glycosylation sites. It has 4 isoforms produced by alternative splicing with the molecular weight of 31 kDa, 27 kDa,34 kDa and 30 kDa.

Protocols

Product Specific Protocols
FC protocol for CL594 KLK11 antibody CL594-67427Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...