CoraLite® Plus 488-conjugated KLK11 Monoclonal antibody

KLK11 Monoclonal Antibody for IF-P
Cat No. CL488-67427
Clone No.1E2B4

Host / Isotype

Mouse / IgG1

Reactivity

Human, Pig, Rat

Applications

IF-P

Hippostasin, hK11, Kallikrein 11, KLK11, PRSS20, Serine protease 20, TLSP, Trypsin like protease

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman breast cancer tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67427 targets KLK11 in IF-P applications and shows reactivity with Human, Pig, Rat samples.

Tested Reactivity Human, Pig, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29895

Product name: Recombinant human KLK11 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 58-250 aa of BC022068

Sequence: LTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN

Predict reactive species
Full Name kallikrein-related peptidase 11
Calculated Molecular Weight 250 aa, 27 kDa
Observed Molecular Weight 30-40 kDa
GenBank Accession NumberBC022068
Gene Symbol KLK11
Gene ID (NCBI) 11012
RRIDAB_2919469
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9UBX7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

KLK11(Kallikrein-11) is also named as PRSS20, TLSP and belongs to the peptidase S1 family and Kallikrein subfamily. It is a multifunctinal protease cleaving several substrates for kallikrein and trypsin and involved in normal physiology processes in bronchus. This full length protein has a signal peptide, a propeptide and four glycosylation sites. It has 4 isoforms produced by alternative splicing with the molecular weight of 31 kDa, 27 kDa,34 kDa and 30 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 KLK11 antibody CL488-67427Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...