• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated KPNA4 Recombinant monoclonal antibody

KPNA4 Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL488-82898-2
Clone No.230098H1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

QIP1, KPNA 4, Karyopherin subunit alpha-4, IPOA3, Importin subunit alpha-3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU2OS cells
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82898-2 targets KPNA4 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3133

Product name: Recombinant human KPNA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC034493

Sequence: MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFL

Predict reactive species
Full Name karyopherin alpha 4 (importin alpha 3)
Calculated Molecular Weight 521 aa, 58 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC034493
Gene Symbol KPNA4
Gene ID (NCBI) 3840
RRIDAB_3673104
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00629
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

KPNA4, also named importin subunit alpha-3, karyopherin-alpha4, is a cytoplasmic protein that recognizes nuclear localization signals (NLSs) and dock NLS-containing proteins to the nuclear pore complex. Nuclear import, mediated in part by karyopherin-α (KPNA)/importin-α subtypes, regulates transcription factor access to the genome and determines cell fate. KPNA4-mediated nuclear transport of Ras-responsive element-binding protein (RREB1), which sustains Ras/ERK pathway signaling through repressing miR-143/145 expression (PMID: 31822798). KPNA4 is one of the main isoforms that is activated in many human cancers. KPNA4 expression was elevated in head and neck of squamous cell carcinoma (PMID: 33188837).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 KPNA4 antibody CL488-82898-2Download protocol
IF protocol for CL Plus 488 KPNA4 antibody CL488-82898-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...