KRCC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• KRCC1 Polyclonal antibody, PBS Only (16916-1-PBS)

• 

  WB analysis using 16916-1-AP (same clone as 16916-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 16916-1-AP (KRCC1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16916-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 16916-1-AP (same clone as 16916-1-PBS)

  WB result of KRCC1 antibody (16916-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-KRCC1 transfected MCF-7 cells. This data was developed using the same antibody clone with 16916-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16916-1-AP (same clone as 16916-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 16916-1-AP (KRCC1 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16916-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

KRCC1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16916-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16916-1-PBS targets KRCC1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10157

  Product name: Recombinant human KRCC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC107580

  Sequence: MKHSKKTYDSFQDELEDYIKVQKARGLEPKTCFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLSYCQFTRDCFSEKPVPLNFNQQEYICGSHGVEHRVYKHFSSDNSTSTHQASHKQIHQKRKRHPEEGREKSEEERSKHKRKKKLRGN

• Full Name: lysine-rich coiled-coil 1
• Calculated Molecular Weight: 187 aa, 22 kDa
• Observed Molecular Weight: 31-35 kDa
• GenBank Accession Number: BC107580
• Gene Symbol: KRCC1
• Gene ID (NCBI): 51315
• RRID: AB_2878331
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPI7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.