CACNA1C Polyclonal antibody

CACNA1C Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 21774-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, FC (Intra), ELISA

CACH2, CACN2, CACNL1A1, Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle, CCHL1A1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue
Positive IHC detected inmouse brain tissue, rat brain tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21774-1-AP targets CACNA1C in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16455

Product name: Recombinant human L-VOCC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1835-2135 aa of BC146846

Sequence: EVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPVPTLRLEGVESSEKLNSSFPSIHCGSWAETTPGGGGSSAARRVRPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL

Predict reactive species
Full Name calcium channel, voltage-dependent, L type, alpha 1C subunit
Calculated Molecular Weight249 kDa
Observed Molecular Weight249 kDa
GenBank Accession NumberBC146846
Gene Symbol CACNA1C
Gene ID (NCBI) 775
RRIDAB_2878918
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13936
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calcium voltage-gated channel subunit alpha1 C (CACNA1C, also known as CACH2 and Cav1.2) couples transient activation of inward calcium current to transcriptional regulation and plays an important role in dendritic development, neuronal survival, synaptic plasticity, memory formation, learning, and behavior (PMID: 21248242;  16251435; 20169575; 19047462; 18174367). Genetic variation in CACNA1C has also been associated with depression, schizophrenia, and autism spectrum disorders, as well as changes in brain function and structure in control subjects who have no diagnosable psychiatric illness (PMID: 22705413).

Protocols

Product Specific Protocols
FC protocol for CACNA1C antibody 21774-1-APDownload protocol
IF protocol for CACNA1C antibody 21774-1-APDownload protocol
IHC protocol for CACNA1C antibody 21774-1-APDownload protocol
WB protocol for CACNA1C antibody 21774-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

Phytomedicine

Protective role and mechanism of snakegourd peel against myocardial infarction in rats.

Authors - Guanlin Yang
mouseWB

Antioxid Redox Signal

Anthracycline-induced atrial structural and electrical remodeling characterizes early cardiotoxicity and contributes to atrial conductive instability and dysfunction.

Authors - Ruopeng Tan
ratWB

Front Immunol

Interleukin-6-Mediated-Ca2+ Handling Abnormalities Contributes to Atrial Fibrillation in Sterile Pericarditis Rats.

Authors - Jie Liao
humanWB

Reprod Biol Endocrinol

In vitro fertilization with frozen embryo transfer increased histamine-mediated contractile sensitivity via PKCβ in human umbilical vein

Authors - Jiaqi Tang
ratWB

Mol Nutr Food Res

Quercetin Attenuates Ethanol-Induced Iron Uptake and Myocardial Injury by Regulating the Angiotensin II-L-Type Calcium Channel.

Authors - Xiaoping Guo
mouse,humanWB

Commun Biol

Cytosolic peptides encoding CaV1 C-termini downregulate the calcium channel activity-neuritogenesis coupling.

Authors - Yaxiong Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Wu (Verified Customer) (07-16-2021)

Works good for IHC assay

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: glandular lumen
CACNA1C Antibody Immunohistochemistry validation (1:100 dilution) in glandular lumen (Cat no:21774-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...