CoraLite® Plus 488-conjugated L-VOCC Polyclonal antibody

• 

  IF Staining of mouse brain using CL488-21774

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CoraLite® Plus 488 L-VOCC antibody (CL488-21774) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using CL488-21774

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CoraLite® Plus 488 L-VOCC antibody (CL488-21774) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HeLa using CL488-21774

  1X10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human L-VOCC (CL488-21774) (red), or 0.8 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

L-VOCC Polyclonal Antibody for IF-P, FC (Intra)

Cat No. CL488-21774

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P, FC (Intra)

Synonyms

CACNA1C, CACH2, CACN2, CACNL1A1, Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle

---

Tested Applications

• Positive IF-P detected in: mouse brain tissue
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-21774 targets L-VOCC in IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16455

  Product name: Recombinant human L-VOCC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1835-2135 aa of BC146846

  Sequence: EVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPVPTLRLEGVESSEKLNSSFPSIHCGSWAETTPGGGGSSAARRVRPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL

• Full Name: calcium channel, voltage-dependent, L type, alpha 1C subunit
• Calculated Molecular Weight: 249 kDa
• GenBank Accession Number: BC146846
• Gene Symbol: CACNA1C
• Gene ID (NCBI): 775
• RRID: AB_3084055
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13936
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Calcium voltage-gated channel subunit alpha1 C (CACNA1C, also known as CACH2 and Cav1.2) couples transient activation of inward calcium current to transcriptional regulation and plays an important role in dendritic development, neuronal survival, synaptic plasticity, memory formation, learning, and behavior (PMID: 21248242;  16251435; 20169575; 19047462; 18174367). Genetic variation in CACNA1C has also been associated with depression, schizophrenia, and autism spectrum disorders, as well as changes in brain function and structure in control subjects who have no diagnosable psychiatric illness (PMID: 22705413).