LACTB2 Monoclonal antibody

• 

  WB analysis of A549 using 67399-1-Ig

  WB result of LACTB2 antibody (67399-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LACTB2 transfected A549 cells.

• 

  WB analysis using 67399-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67399-1-Ig (LACTB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 67399-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67399-1-Ig (LACTB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67399-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67399-1-Ig (LACTB2 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67399-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67399-1-Ig (LACTB2 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human liver cancer using 67399-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using LACTB2 antibody (67399-1-Ig, Clone: 1G6B1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of human liver cancer using 67399-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using LACTB2 antibody (67399-1-Ig, Clone: 1G6B1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of mouse liver using 67399-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using LACTB2 antibody (67399-1-Ig, Clone: 1G6B1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 67399-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using LACTB2 antibody (67399-1-Ig, Clone: 1G6B1 ) at dilution of 1:2000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004).

• Featured Product
• KD/KO Validated

LACTB2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 67399-1-Ig

Clone No.1G6B1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

EC:3.1.27.-, CGI-83, CGI83, CGI 83, Beta-lactamase-like protein 2

---

Tested Applications

• Positive WB detected in: A549 cells, NIH/3T3 cells, HeLa cells, HEK-293 cells, Jurkat cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human liver cancer tissue, mouse liver tissue
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67399-1-Ig targets LACTB2 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10231

  Product name: Recombinant human LACTB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-288 aa of BC000878

  Sequence: MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL

• Full Name: lactamase, beta 2
• Calculated Molecular Weight: 288 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC000878
• Gene Symbol: LACTB2
• Gene ID (NCBI): 51110
• RRID: AB_2882642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q53H82
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.