LACTB2 Monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• LACTB2 Monoclonal antibody, PBS Only (Capture) (67399-1-PBS)

• Featured Product
• KD/KO Validated

LACTB2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 67399-1-PBS Copied!

Clone No. 1G6B1

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Synonyms

1G6B1, Beta-lactamase-like protein 2, CGI 83, CGI83, CGI-83

• 

  WB analysis of A549 using 67399-1-Ig (same clone as 67399-1-PBS)

  WB result of LACTB2 antibody (67399-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LACTB2 transfected A549 cells. This data was developed using the same antibody clone with 67399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67399-1-Ig (same clone as 67399-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67399-1-Ig (LACTB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 67399-1-Ig (same clone as 67399-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67399-1-Ig (LACTB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 67399-1-Ig (same clone as 67399-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67399-1-Ig (LACTB2 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 67399-1-Ig (same clone as 67399-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67399-1-Ig (LACTB2 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human liver using 67399-1-Ig (same clone as 67399-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human liver tissue using LACTB2 antibody (67399-1-Ig, Clone: 1G6B1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human liver using 67399-1-Ig (same clone as 67399-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human liver tissue using LACTB2 antibody (67399-1-Ig, Clone: 1G6B1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human liver cancer using 67399-1-Ig (same clone as 67399-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using LACTB2 antibody (67399-1-Ig, Clone: 1G6B1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human liver cancer using 67399-1-Ig (same clone as 67399-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using LACTB2 antibody (67399-1-Ig, Clone: 1G6B1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse liver using 67399-1-Ig (same clone as 67399-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using LACTB2 antibody (67399-1-Ig, Clone: 1G6B1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 67399-1-Ig (same clone as 67399-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using LACTB2 antibody (67399-1-Ig, Clone: 1G6B1 ) at dilution of 1:2000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004). This data was developed using the same antibody clone with 67399-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP50726-4

  Cytometric bead array standard curve of MP50726-4, LACTB2 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67399-1-PBS. Detection antibody: 67399-4-PBS. Standard:Ag10231. Range: 3.125-100 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LACTB2 in ?

Chat with Able

---

Product Information

67399-1-PBS targets LACTB2 as part of a matched antibody pair:

MP50726-4: 67399-1-PBS capture and 67399-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10231

  Product name: Recombinant human LACTB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-288 aa of BC000878

  Sequence: MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL

• Full Name: lactamase, beta 2
• Calculated Molecular Weight: 288 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC000878
• Gene Symbol: LACTB2
• Gene ID (NCBI): 51110
• RRID: AB_2882642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q53H82
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.