CoraLite® Plus 488-conjugated LAMP5 Recombinant monoclonal antibody

• 

  IF Staining of SH-SY5Y using CL488-82992-2

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using CoraLite® Plus 488 LAMP5 antibody (CL488-82992-2, Clone: 230102F12 ) at dilution of 1:200.

LAMP5 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-82992-2

Clone No.230102F12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

C20orf103, 230102F12, BAD-LAMP, Brain and dendritic cell-associated LAMP, Brain-associated LAMP-like protein

---

Tested Applications

• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82992-2 targets LAMP5 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33894

  Product name: Recombinant human LAMP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-235 aa of BC050727

  Sequence: EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEREQLEE

• Full Name: chromosome 20 open reading frame 103
• Observed Molecular Weight: 31-35 kDa
• GenBank Accession Number: BC050727
• Gene Symbol: LAMP5
• Gene ID (NCBI): 24141
• RRID: AB_3673165
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UJQ1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

LAMP5 (Lysosome-associated membrane glycoprotein 5) is also named as BAD-LAMP and C20orf103. BAD-LAMP is a novel biomarker of nonactivated human plasmacytoid dendritic cells (PMID: 21642595). LAMP5 may be one of the key genes in the development of Multiple myeloma (MM) as well as its recurrence  (PMID: 37033323). LAMP5 is a mammalian ortholog of the Caenorhabditis elegans protein, UNC-46, which functions as a sorting factor to localize the vesicular GABA transporter UNC-47 to synaptic vesicles (PMID: 30867010). It was localized exclusively in inhibitory synaptic terminals (PMID: 30867010).