LARP1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67810-1-Ig (same clone as 67810-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67810-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67810-1-Ig (same clone as 67810-1-PBS)

  WB result of LARP1 antibody (67810-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LARP1 transfected HEK-293 cells. This data was developed using the same antibody clone with 67810-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67810-1-Ig (same clone as 67810-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67810-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67810-1-Ig (same clone as 67810-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67810-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 67810-1-Ig (same clone as 67810-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67810-1-Ig (LARP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67810-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 67810-1-Ig (same clone as 67810-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67810-1-Ig (LARP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67810-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67810-1-Ig (same clone as 67810-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LARP1 antibody (67810-1-Ig, Clone: 2E9F2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). Blue (DAPI). This data was developed using the same antibody clone with 67810-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67810-1-Ig (same clone as 67810-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LARP1 antibody (67810-1-Ig, Clone: 2E9F2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67810-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LARP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67810-1-PBS

Clone No.2E9F2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

2E9F2, KIAA0731, La related protein 1, La-related protein 1, LARP

---

Product Information

67810-1-PBS targets LARP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29993

  Product name: Recombinant human LARP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-283 aa of BC033856

  Sequence: MPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK

• Full Name: La ribonucleoprotein domain family, member 1
• Calculated Molecular Weight: 1096 aa, 124 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC033856
• Gene Symbol: LARP1
• Gene ID (NCBI): 23367
• RRID: AB_2918573
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6PKG0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.