LARP1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• LARP1 Monoclonal antibody (67810-1-Ig)

• Featured Product
• KD/KO Validated

LARP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67810-1-Ig Copied!

Clone No. 2E9F2

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

2E9F2, KIAA0731, La related protein 1, La-related protein 1, LARP

• 

  WB analysis using 67810-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 67810-1-Ig

  WB result of LARP1 antibody (67810-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LARP1 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HSC-T6 using 67810-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 67810-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 67810-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67810-1-Ig (LARP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 67810-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67810-1-Ig (LARP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 67810-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LARP1 antibody (67810-1-Ig, Clone: 2E9F2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). Blue (DAPI).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 67810-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LARP1 antibody (67810-1-Ig, Clone: 2E9F2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LARP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67810-1-Ig targets LARP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29993

  Product name: Recombinant human LARP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-283 aa of BC033856

  Sequence: MPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK

• Full Name: La ribonucleoprotein domain family, member 1
• Calculated Molecular Weight: 1096 aa, 124 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC033856
• Gene Symbol: LARP1
• Gene ID (NCBI): 23367
• RRID: AB_2918573
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6PKG0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The LARP1 Monoclonal antibody (2E9F2), catalog number 67810-1-Ig, has a total of 1 citation. The citation appears in Frontiers in Endocrinology (Lausanne), published in 2026. The associated research field is breast cancer, specifically examining the role of LARP1 in tumor progression and immune microenvironment remodeling.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Front Endocrinol (Lausanne); The role of LARP1 in breast cancer progression: from prognosis to immune microenvironment remodeling.; Authors - Yangtian Ye