LARP1 Monoclonal antibody

• 

  WB analysis using 67810-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 67810-1-Ig

  WB result of LARP1 antibody (67810-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LARP1 transfected HEK-293 cells.

• 

  WB analysis of HSC-T6 using 67810-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 67810-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 67810-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67810-1-Ig (LARP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 67810-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67810-1-Ig (LARP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 67810-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LARP1 antibody (67810-1-Ig, Clone: 2E9F2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). Blue (DAPI).

• 

  IF Staining of HepG2 using 67810-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LARP1 antibody (67810-1-Ig, Clone: 2E9F2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

LARP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67810-1-Ig

Clone No.2E9F2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

2E9F2, KIAA0731, La related protein 1, La-related protein 1, LARP

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67810-1-Ig targets LARP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29993

  Product name: Recombinant human LARP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-283 aa of BC033856

  Sequence: MPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK

• Full Name: La ribonucleoprotein domain family, member 1
• Calculated Molecular Weight: 1096 aa, 124 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC033856
• Gene Symbol: LARP1
• Gene ID (NCBI): 23367
• RRID: AB_2918573
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6PKG0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.