×
Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

LARP1 Monoclonal antibody

LARP1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67810-1-Ig
Clone No. 2E9F2
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

2E9F2, KIAA0731, La related protein 1, La-related protein 1, LARP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of various lysates using LARP1 Monoclonal antibody (67810-1-Ig)

    WB analysis using 67810-1-Ig

    Various lysates were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HEK-293 cells using LARP1 Monoclonal antibody (67810-1-Ig)

    WB analysis of HEK-293 using 67810-1-Ig

    WB result of LARP1 antibody (67810-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LARP1 transfected HEK-293 cells.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HSC-T6 cells using LARP1 Monoclonal antibody (67810-1-Ig)

    WB analysis of HSC-T6 using 67810-1-Ig

    HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of NIH/3T3 cells using LARP1 Monoclonal antibody (67810-1-Ig)

    WB analysis of NIH/3T3 using 67810-1-Ig

    NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67810-1-Ig (LARP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human ovary tumor tissue using LARP1 Monoclonal antibody (67810-1-Ig)

    IHC staining of human ovary tumor using 67810-1-Ig

    Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67810-1-Ig (LARP1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human ovary tumor tissue using LARP1 Monoclonal antibody (67810-1-Ig)

    IHC staining of human ovary tumor using 67810-1-Ig

    Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67810-1-Ig (LARP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using LARP1 Monoclonal antibody (67810-1-Ig)

    IF Staining of HepG2 using 67810-1-Ig

    Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LARP1 antibody (67810-1-Ig, Clone: 2E9F2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). Blue (DAPI).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using LARP1 Monoclonal antibody (67810-1-Ig)

    IF Staining of HepG2 using 67810-1-Ig

    Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using LARP1 antibody (67810-1-Ig, Clone: 2E9F2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Able AI
Able AI
What's the best dilution for LARP1 in ?

Tested Applications

Positive WB detected inHCT 116 cells, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells
Positive IHC detected inhuman ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67810-1-Ig targets LARP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29993

Product name: Recombinant human LARP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-283 aa of BC033856

Sequence: MPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK

Predict reactive species
Full Name La ribonucleoprotein domain family, member 1
Calculated Molecular Weight 1096 aa, 124 kDa
Observed Molecular Weight140-150 kDa
GenBank Accession NumberBC033856
Gene Symbol LARP1
Gene ID (NCBI) 23367
RRIDAB_2918573
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ6PKG0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for LARP1 antibody 67810-1-IgDownload protocol
IHC protocol for LARP1 antibody 67810-1-IgDownload protocol
WB protocol for LARP1 antibody 67810-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The LARP1 Monoclonal antibody (2E9F2), catalog number 67810-1-Ig, has a total of 1 citation. The citation appears in Frontiers in Endocrinology (Lausanne), published in 2026. The associated research field is breast cancer, specifically examining the role of LARP1 in tumor progression and immune microenvironment remodeling.

Automatically generated from the 1 publication citations by Able AI.
SpeciesApplicationTitle

Front Endocrinol (Lausanne)

The role of LARP1 in breast cancer progression: from prognosis to immune microenvironment remodeling.

Authors - Yangtian Ye
View Article
||
New chat

Able™

正在加载，请稍候...