CoraLite® Plus 488-conjugated LARP1 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-13708

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 LARP1 antibody (CL488-13708) at dilution of 1:200.

• Featured Product
• KD/KO Validated

LARP1 Polyclonal Antibody for IF/ICC

Cat No. CL488-13708

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, drosophila

Applications

IF/ICC

Synonyms

KIAA0731, La related protein 1, LARP, LARP1

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-13708 targets LARP1 in IF/ICC applications and shows reactivity with human, mouse, rat, drosophila samples.

• Tested Reactivity: human, mouse, rat, drosophila
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4645

  Product name: Recombinant human LARP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-283 aa of BC033856

  Sequence: MPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVREDAKWTSQHSNTQTLGK

• Full Name: La ribonucleoprotein domain family, member 1
• Calculated Molecular Weight: 1096 aa, 124 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC033856
• Gene Symbol: LARP1
• Gene ID (NCBI): 23367
• RRID: AB_3083946
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PKG0
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

LARP1, full named as La-related Protein 1, is an oncogenic RNA-binding protein required for ribosome biogenesis and cancer cell survival. (PMID: 32286153)It's has been proposed to function downstream of mTORC1 to regulate the translation of 5'TOP mRNAs such as those encoding ribosome proteins (RP). (PMID: 28650797) LARP1 has 2 isoforms with MW of 123-150KDa. With CL647, immunoflorecence detected location in cytoplasm.