• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated LATS1 Polyclonal antibody

LATS1 Polyclonal Antibody for IF/ICC
Cat No. CL488-17049

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

EC:2.7.11.1, h-warts, LATS 1, Serine/threonine-protein kinase LATS1, WARTS

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17049 targets LATS1 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10709

Product name: Recombinant human LATS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-135 aa of BC015665

Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI

Predict reactive species
Full Name LATS, large tumor suppressor, homolog 1 (Drosophila)
Calculated Molecular Weight 15 kDa, 127 kDa
Observed Molecular Weight 140-150 kDa, 120 kDa
GenBank Accession NumberBC015665
Gene Symbol LATS1
Gene ID (NCBI) 9113
RRIDAB_3083996
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6PJG3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

LATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongs to the AGC Ser/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268). LATS1 also can be detected as 120 kDa and 140-150 kDa, and play a key role in the regulation of Hippo pathway (PMID: 27940445).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 LATS1 antibody CL488-17049Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...