LAX1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LAX1 Polyclonal antibody, PBS Only (21557-1-PBS)

• 

  WB analysis using 21557-1-AP (same clone as 21557-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21557-1-AP (LAX1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21557-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 21557-1-AP (same clone as 21557-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21557-1-AP (LAX1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21557-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 21557-1-AP (same clone as 21557-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21557-1-AP (LAX1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 21557-1-AP (same clone as 21557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 21557-1-AP (LAX1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 21557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 21557-1-AP (same clone as 21557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 21557-1-AP (LAX1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 21557-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 21557-1-AP (same clone as 21557-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 21557-1-AP (LAX1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21557-1-PBS in a different storage buffer formulation.

LAX1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21557-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

21557-1-PBS targets LAX1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15599

  Product name: Recombinant human LAX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-322 aa of BC069650

  Sequence: MPLLTLPQTRQRAKNIYDILPWRQEDLGRHESRSMRIFSTESLLSRNSESPEHVPSQAGNAFQEHTAHIHATEYAVGIYDNAMVPQMCGNLTPSAHCINVRASRDCASISSEDSHDYVNVPTAEEIAETLASTKSPSRNLFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQERQLWVAFQCCRDYENVPAADPSGSQQQAEKDVPSSNIGHVEDKTDDPGTHVQCVKRTFLASGDYADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLLPDE

• Full Name: lymphocyte transmembrane adaptor 1
• Calculated Molecular Weight: 398 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC069650
• Gene Symbol: LAX1
• Gene ID (NCBI): 54900
• RRID: AB_10732821
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWV1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.