LELP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LELP1 Polyclonal antibody, PBS Only (32483-1-PBS)

• 

  WB analysis using 32483-1-AP (same clone as 32483-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32483-1-AP (LELP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32483-1-PBS in a different storage buffer formulation.

LELP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32483-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

Late cornified envelope-like proline-rich protein 1, Novel small proline-rich protein

---

Product Information

32483-1-PBS targets LELP1 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36831

  Product name: Recombinant human LELP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-98 aa of BC130507

  Sequence: MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE

• Full Name: late cornified envelope-like proline-rich 1
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC130507
• Gene Symbol: LELP1
• Gene ID (NCBI): 149018
• RRID: AB_3742629
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5T871
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Late cornified envelope-like proline-rich protein 1 (LELP1) is part of the epidermal differentiation complex (EDC), a cluster of genes that encode proteins essential for the differentiation of keratinocytes and the formation of the stratum corneum (PMID: 34112911). A single nucleotide polymorphism (SNP) in the LELP1 gene has been associated with atopic dermatitis, a chronic inflammatory skin disorder characterized by elevated levels of serum immunoglobulin E (IgE) and severe skin inflammation (PMID: 26608070).