LGR4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LGR4 Polyclonal antibody, PBS Only (20150-1-PBS)

• 

  IHC staining of human small intestine using 20150-1-AP (same clone as 20150-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 20150-1-AP (LGR4 antibody) at dilution of 1:2000 (under 10x lens). This data was developed using the same antibody clone with 20150-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 20150-1-AP (same clone as 20150-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 20150-1-AP (LGR4 antibody) at dilution of 1:2000 (under 40x lens). This data was developed using the same antibody clone with 20150-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 20150-1-AP (same clone as 20150-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 20150-1-AP (LGR4 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 20150-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 20150-1-AP (same clone as 20150-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 20150-1-AP (LGR4 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 20150-1-PBS in a different storage buffer formulation.

LGR4 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 20150-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

20150-1-PBS targets LGR4 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13695

  Product name: Recombinant human LGR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-376 aa of BC033039

  Sequence: PLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHHLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNL

• Full Name: leucine-rich repeat-containing G protein-coupled receptor 4
• Calculated Molecular Weight: 104 kDa
• GenBank Accession Number: BC033039
• Gene Symbol: LGR4
• Gene ID (NCBI): 55366
• RRID: AB_2878648
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BXB1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LGR4, also known as GPR48, is a membrane of the leucine-rich GPCR family. LGR4 is composed of a large NH2-terminal extracellular domain containing 18 LRRs, the seven membrane-spanning segments, and a COOH-terminal intracellular domain. LGR4 is a receptor for R-spondins that potentiates the canonical Wnt signaling pathway and is involved in the formation of various organs. It has also been shown that LGR4 regulates cyclic AMP/protein kinase A (PKA) signalling. (PMID: 23756652; 17178856; 24212090)