LHCGR Polyclonal antibody

• 

  WB analysis of mouse ovary using 26424-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 26424-1-AP (LHCGR Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human thyroid cancer using 26424-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 26424-1-AP (LHCGR Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human thyroid cancer using 26424-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 26424-1-AP (LHCGR Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 26424-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 26424-1-AP (LHCGR antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary using 26424-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 26424-1-AP (LHCGR Antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human ovary using 26424-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 26424-1-AP (LHCGR Antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of mouse ovary using 26424-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 26424-1-AP (LHCGR Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse ovary using 26424-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 26424-1-AP (LHCGR Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse ovary using 26424-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse ovary tissue using LHCGR antibody (26424-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

LHCGR Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 26424-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

LCGR, LGR2, LH R, LH receptor, LH/CG-R

---

Tested Applications

• Positive WB detected in: mouse ovary tissue
• Positive IHC detected in: human ovary cancer tissue, human ovary tissue, human thyroid cancer tissue, mouse ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse ovary tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:100-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IF: See 2 publications below

Product Information

26424-1-AP targets LHCGR in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19259

  Product name: Recombinant human LHCGR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 49-219 aa of BC157028

  Sequence: AGLTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFR

• Full Name: LHCGR
• Calculated Molecular Weight: 699 aa, 79 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC157028
• Gene Symbol: LHCGR
• Gene ID (NCBI): 3973
• RRID: AB_2880511
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22888
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LHCGR, also known as LHR or LSHR, belongs to the rhodopsin-like family of G protein-coupled receptors (GPCRs) and plays a crucial role in the regulation of gonadal functions by stimulating steroidogenesis in response to luteinizing hormone (LH) or hCG (PMID: 15866423). Mutations in LHCGR gene result in familial male-limited precocious puberty, Leydig cell hypoplasia, and empty follicle syndrome (PMID: 30711030). LHCGR protein consists of 699 amino acids with a calculated molecular weight of 79 kDa. Due to massive glycosylation, the molecular mass of the mature LHCGR is higher (85-100 kDa) than the predicted molecular protein mass of 79 kDa (PMID: 23686864; 15866423; 29075189; 15969756).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Biol Reprod; Interferon-tau infusion into the ovine corpus luteum delays luteolysis; Authors - Aydin Guzeloglu
mouse	WB,IF	Biochem Biophys Res Commun; Effects of hCG on DA neuronal death of Parkinson's disease; Authors - Shi-Min Wang ; KD Validated
mouse	IF	Biol Res; Mouse testicular macrophages can independently produce testosterone and are regulated by Cebpb; Authors - Nengliang Duan