• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated LHCGR Polyclonal antibody

LHCGR Polyclonal Antibody for IF-P
Cat No. CL647-26424

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

LCGR, LGR2, LH R, LH receptor, LH/CG-R

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse ovary tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-26424 targets LHCGR in IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19259

Product name: Recombinant human LHCGR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 49-219 aa of BC157028

Sequence: AGLTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFR

Predict reactive species
Full Name LHCGR
Calculated Molecular Weight 699 aa, 79 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC157028
Gene Symbol LHCGR
Gene ID (NCBI) 3973
RRIDAB_2934962
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP22888
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

LHCGR, also known as LHR or LSHR, belongs to the rhodopsin-like family of G protein-coupled receptors (GPCRs) and plays a crucial role in the regulation of gonadal functions by stimulating steroidogenesis in response to luteinizing hormone (LH) or hCG (PMID: 15866423). Mutations in LHCGR gene result in familial male-limited precocious puberty, Leydig cell hypoplasia, and empty follicle syndrome (PMID: 30711030). LHCGR protein consists of 699 amino acids with a calculated molecular weight of 79 kDa. Due to massive glycosylation, the molecular mass of the mature LHCGR is higher (85-100 kDa) than the predicted molecular protein mass of 79 kDa (PMID: 23686864; 15866423; 29075189; 15969756).

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 LHCGR antibody CL647-26424Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...