CoraLite® Plus 647-conjugated LHCGR Polyclonal antibody

• 

  IF Staining of mouse ovary using CL647-26424

  Immunofluorescent analysis of (4% PFA) fixed mouse ovary tissue using CoraLite® Plus 647 LHCGR antibody (CL647-26424) at dilution of 1:200.

• 

  IF Staining of mouse ovary using CL647-26424

  Immunofluorescent analysis of (4% PFA) fixed mouse ovary tissue using CoraLite® Plus 647 LHCGR antibody (CL647-26424) at dilution of 1:200.

• Featured Product
• KD/KO Validated

LHCGR Polyclonal Antibody for IF-P

Cat No. CL647-26424

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

Synonyms

FLJ41504, LCGR, LGR2, LH/CG R, LH/CGR, LHCGR, LHR, LHRHR, LSH R, Luteinizing hormone receptor

---

Tested Applications

• Positive IF-P detected in: mouse ovary tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-26424 targets LHCGR in IF-P applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19259

  Product name: Recombinant human LHCGR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 49-219 aa of BC157028

  Sequence: AGLTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFR

• Full Name: LHCGR
• Calculated Molecular Weight: 699 aa, 79 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC157028
• Gene Symbol: LHCGR
• Gene ID (NCBI): 3973
• RRID: AB_2934962
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22888
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

LHCGR, also known as LHR or LSHR, belongs to the rhodopsin-like family of G protein-coupled receptors (GPCRs) and plays a crucial role in the regulation of gonadal functions by stimulating steroidogenesis in response to luteinizing hormone (LH) or hCG (PMID: 15866423). Mutations in LHCGR gene result in familial male-limited precocious puberty, Leydig cell hypoplasia, and empty follicle syndrome (PMID: 30711030). LHCGR protein consists of 699 amino acids with a calculated molecular weight of 79 kDa. Due to massive glycosylation, the molecular mass of the mature LHCGR is higher (85-100 kDa) than the predicted molecular protein mass of 79 kDa (PMID: 23686864; 15866423; 29075189; 15969756).