Product Information
21516-1-PBS targets LHX6 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16047 Product name: Recombinant human LHX6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 276-363 aa of BC103937 Sequence: KHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY Predict reactive species |
| Full Name | LIM homeobox 6 |
| Calculated Molecular Weight | 392 aa, 43 kDa |
| Observed Molecular Weight | 38-40 kDa |
| GenBank Accession Number | BC103937 |
| Gene Symbol | LHX6 |
| Gene ID (NCBI) | 26468 |
| RRID | AB_2878875 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UPM6 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
LHX6 is a LIM homeodomain protein similar in structure to ISL-1. LHX6, like ISL-1, contains tandem LIM domains and a homeodomain that regulate its activity both in cis and through interaction with cell-specific factors. LHX6 is highly expressed in the neural crest-derived mesenchyme throughout odontogenesis and down-regulated after birth. However, LHX6 is also expressed in the palate, oral, and dental epithelium during craniofacial development. LHX6 regulates the migration and specification of neuron subtypes and marks specific neurons. The molecular weight of Endogenous LHX6 is 40 kDa, but the LHX6-PITX2 protein complex is 56 kDa (PMID: 23229549).

