CoraLite® Plus 488-conjugated LMCD1 Monoclonal antibody

LMCD1 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67834
Clone No.2A7B3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

LIM and cysteine-rich domains protein 1, Dyxin

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67834 targets LMCD1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28331

Product name: Recombinant human LMCD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-365 aa of BC000646

Sequence: MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

Predict reactive species
Full Name LIM and cysteine-rich domains 1
Calculated Molecular Weight 41 kDa
Observed Molecular Weight~40 kDa
GenBank Accession NumberBC000646
Gene Symbol LMCD1
Gene ID (NCBI) 29995
RRIDAB_3084380
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NZU5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

LIM and cysteine-rich domains-1 (LMCD1) is a member of the LIM protein family, which contains an N-terminal cysteine-rich region, two C-terminal LIM domains and a central PET (Prickle, Espinas, and Testin) domain. LMCD1 has been reported in cardiac tissues and lung acting as a transcriptional repressor for GATA6. The mutations of LMCD1 promote cell migration and tumor metastasis in hepatocellular carcinoma. (PMID: 31501411) It has calculated molecular weight around 41kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 LMCD1 antibody CL488-67834Download protocol
IF protocol for CL Plus 488 LMCD1 antibody CL488-67834Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...