LMCD1 Monoclonal antibody

LMCD1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67834-1-Ig
Clone No.2A7B3

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Dyxin, LMCD1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, human placenta tissue
Positive IHC detected inhuman colon tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

67834-1-Ig targets LMCD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28331

Product name: Recombinant human LMCD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-365 aa of BC000646

Sequence: MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

Predict reactive species
Full Name LIM and cysteine-rich domains 1
Calculated Molecular Weight 41 kDa
Observed Molecular Weight~40 kDa
GenBank Accession NumberBC000646
Gene Symbol LMCD1
Gene ID (NCBI) 29995
RRIDAB_2918596
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NZU5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LIM and cysteine-rich domains-1 (LMCD1) is a member of the LIM protein family, which contains an N-terminal cysteine-rich region, two C-terminal LIM domains and a central PET (Prickle, Espinas, and Testin) domain. LMCD1 has been reported in cardiac tissues and lung acting as a transcriptional repressor for GATA6. The mutations of LMCD1 promote cell migration and tumor metastasis in hepatocellular carcinoma. (PMID: 31501411) It has calculated molecular weight around 41kDa.

Protocols

Product Specific Protocols
IF protocol for LMCD1 antibody 67834-1-IgDownload protocol
IHC protocol for LMCD1 antibody 67834-1-IgDownload protocol
WB protocol for LMCD1 antibody 67834-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB

Exp Eye Res

TGF-β1-mediated upregulation of LMCD1 drives corneal myofibroblast differentiation and corneal fibrosis

Authors - Yunlan Tang
Loading...
||
New chat Able
正在加载,请稍候...