Product Information
14144-1-PBS targets LMX1A in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5311 Product name: Recombinant human LMX1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-382 aa of BC066353 Sequence: MEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS Predict reactive species |
| Full Name | LIM homeobox transcription factor 1, alpha |
| Calculated Molecular Weight | 43 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC066353 |
| Gene Symbol | LMX1A |
| Gene ID (NCBI) | 4009 |
| RRID | AB_3085429 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TE12 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
LMX1A is a transcription factor that positively regulates insulin gene transcription. LMX1A also plays a role in the development of dopamine-producing neurons during embryogenesis (PMID: 36381759). LMX1A has 2 isoforms with the molecular mass of 15 kDa (LMX1A-4AB) and 43 kDa (Isoform 1). LMX1A-4AB is expressed in testis. Isoform 1 of LMX1A is expressed in many tissues but not found in heart, liver, spleen and testis.
