Product Information
34416-1-PBS targets LOC221710 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag42308 Product name: Recombinant human LOC221710 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-91 aa of BC032356 Sequence: WHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT Predict reactive species |
| Full Name | hypothetical protein LOC221710 |
| Observed Molecular Weight | 19-23 kDa |
| GenBank Accession Number | BC032356 |
| Gene Symbol | LOC221710 |
| Gene ID (NCBI) | 221710 |
| RRID | AB_3743197 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P0DJ93 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
LOC221710 is a provisional gene annotation identifier used in human genomic databases (e.g., RefSeq/NCBI) to denote a predicted or poorly characterized locus for which functional annotation remains limited. Genes labeled with "LOC" typically arise from computational gene prediction, transcriptomic evidence, or incomplete cDNA characterization, and may represent protein-coding candidates, long non-coding RNAs (lncRNAs), or pseudogenes. For LOC221710, currently available data suggest that it lacks well-defined protein structure, biochemical function, and experimentally validated biological roles, and it has not yet been assigned an official gene symbol.
