CoraLite® Plus 488-conjugated LPXN Recombinant monoclonal antibody

LPXN Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83657-5
Clone No.240483G10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

LDPL, LDLP, 240483G10

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83657-5 targets LPXN in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34956

Product name: Recombinant human LPXN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 5-132 aa of BC019035

Sequence: DALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSML

Predict reactive species
Full Name leupaxin
Calculated Molecular Weight 43 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC019035
Gene Symbol LPXN
Gene ID (NCBI) 9404
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60711
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

LPXN, also known as Leupaxin, LDPL, belongs to the paxillin family. LPXN Contributes to the regulation of cell adhesion, spreading, and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events (PMID: 20543562). LPXN has four leucine-rich LD-motifs in the N-terminus and four LIM domains in the C-terminus. It may function in cell type-specific signaling by associating with PYK2, a member of the focal adhesion kinase family (PMID: 9565592). Studies in breast cancer implicate LPXN is involved in the regulation of ER action as a co-factor (PMID: 25955236). LPXN is expressed in prostate cancer cells and its expression intensity is directly linked to PCa progression (PMID: 18451096).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 LPXN antibody CL488-83657-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...