LRRC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LRRC1 Polyclonal antibody, PBS Only (10128-2-PBS)

• 

  WB analysis using 10128-2-AP (same clone as 10128-2-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10128-2-AP (LRRC1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10128-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 10128-2-AP (same clone as 10128-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10128-2-AP (LRRC1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10128-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 10128-2-AP (same clone as 10128-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using LRRC1 antibody (10128-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10128-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LRRC1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10128-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Leucine-rich repeat-containing protein 1, LAP and no PDZ protein, LANO adapter protein, LANO

---

Product Information

10128-2-PBS targets LRRC1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0175

  Product name: Recombinant human LRRC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-266 aa of BC003193

  Sequence: SIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELPEQFFQLVKLRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRLPESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELDLGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEISGLTSLTDLVISQNLLETIPDGIGKLK

• Full Name: leucine rich repeat containing 1
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 59 kDa
• GenBank Accession Number: BC003193
• Gene Symbol: LRRC1
• Gene ID (NCBI): 55227
• RRID: AB_2137458
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTT6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LRRC1 consists of 524 amino acids including 16 leucine-rich repeats and a LAP-specific domain. It has been shown to be highly expressed in several human cancers and can participate in the malignant process of cancer cells, such as hepatocellular carcinoma, breast cancer and non-small cell lung cancer. (PMID: 36370237, PMID: 37505155)