LRRC8A/SWELL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LRRC8A/SWELL1 Polyclonal antibody, PBS Only (17155-1-PBS)

• 

  WB analysis using 17155-1-AP (same clone as 17155-1-PBS)

  Mouse brain tissue were subjected to SDS PAGE followed by western blot with 17155-1-AP (LRRC8A/SWELL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17155-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 17155-1-AP (same clone as 17155-1-PBS)

  rat lung tissue were subjected to SDS PAGE followed by western blot with 17155-1-AP (LRRC8A/SWELL1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17155-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 17155-1-AP (same clone as 17155-1-PBS)

  IP result of anti-LRRC8A/SWELL1 (IP:17155-1-AP, 4ug; Detection:17155-1-AP 1:800) with mouse brain tissue lysate 2100 ug. This data was developed using the same antibody clone with 17155-1-PBS in a different storage buffer formulation.

LRRC8A/SWELL1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 17155-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

LRRC8A, HsLRRC8A, KIAA1437, Leucine-rich repeat-containing protein 8A, LRRC8

---

Product Information

17155-1-PBS targets LRRC8A/SWELL1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10062

  Product name: Recombinant human LRRC8A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 464-810 aa of BC051322

  Sequence: SIAQLTGLKELWLYHTAAKIEAPALAFLRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQVVTDVGVHLQKLSINNEGTKLIVLNSLKKMANLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIEEIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFLPADIGLLQNLQNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA

• Full Name: leucine rich repeat containing 8 family, member A
• Calculated Molecular Weight: 810 aa, 94 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC051322
• Gene Symbol: LRRC8A
• Gene ID (NCBI): 56262
• RRID: AB_2918050
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWT6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

LRRC8A, also named as SWELL1, KIAA1437, and LRRC8, belongs to the LRRC8 family. LRRC8A is the essential subunit of the volume-regulated anion channel (VRAC), a key regulator of cell volume homeostasis. It forms heteromeric channels with other LRRC8 family members (B-E) to transport chloride, organic osmolytes, and drugs. This channel is crucial for processes like regulatory volume decrease (RVD), cell proliferation, and migration. Dysfunction of LRRC8A-VRAC is implicated in cancer chemotherapy resistance, stroke, and immune disorders (PMID: 24790029, PMID: 39550567, PMID: 40642832). The molecular weight of LRRC8A is 94 kDa.