LSM8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• LSM8 Polyclonal antibody, PBS Only (10134-1-PBS)

• 

  WB analysis of HeLa using 10134-1-AP (same clone as 10134-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10134-1-AP (LSM8 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10134-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 10134-1-AP (same clone as 10134-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 10134-1-AP (LSM8 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 10134-1-AP (same clone as 10134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10134-1-AP (LSM8 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 10134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 10134-1-AP (same clone as 10134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10134-1-AP (LSM8 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 10134-1-AP (same clone as 10134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10134-1-AP (LSM8 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 10134-1-AP (same clone as 10134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10134-1-AP (LSM8 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 10134-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10134-1-AP (same clone as 10134-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using LSM8 antibody (10134-1-AP) at dilution of 1:1500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10134-1-PBS in a different storage buffer formulation.

LSM8 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10134-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

NAA38, U6 snRNA-associated Sm-like protein LSm8, YJR022W

---

Product Information

10134-1-PBS targets LSM8 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0178

  Product name: Recombinant human LSM8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-96 aa of BC002742

  Sequence: MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH

• Full Name: LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae)
• Calculated Molecular Weight: 14 kDa /75 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC002742
• Gene Symbol: LSM8
• Gene ID (NCBI): 51691
• RRID: AB_513438
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95777
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing[PMID:15075370]. Lsm2-Lsm8 (Lsm stands for Like Sm), binds and stabilizes the 3′ end of the spliceosomal U6 snRNA Lsm proteins facilitate the annealing of U6 snRNA with U4 snRNA in vitro and interact with the U4/U6 annealing factor Prp24, suggesting that Lsm proteins function in U4/U6 snRNP formation in vivo [PMID:15485930, 17251193].