LTBP1 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

LTBP1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85820-1-PBS
Clone No.250127A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Latent-transforming growth factor beta-binding protein 1, LTBP 1, TGF beta1 BP 1, TGF-beta1-BP-1, Transforming growth factor beta-1-binding protein 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85820-1-PBS targets LTBP1 as part of a matched antibody pair:

MP02129-1: 85820-1-PBS capture and 85820-3-PBS detection (validated in Cytometric bead array)

MP02129-2: 85820-2-PBS capture and 85820-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25392

Product name: Recombinant human LTBP1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 600-739 aa of BC130289

Sequence: CSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCH

Predict reactive species
Full Name latent transforming growth factor beta binding protein 1
Calculated Molecular Weight 1721 aa, 187 kDa
Observed Molecular Weight150 kDa
GenBank Accession NumberBC130289
Gene Symbol LTBP1
Gene ID (NCBI) 4052
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14766
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Latent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) is a large extracellular matrix protein that belongs to the latent TGF-beta binding protein family. It plays a crucial role in the regulation of TGF-beta, a multifunctional cytokine involved in various cellular processes such as cell growth, differentiation, and immune response. LTBP1 is essential for TGF-beta folding, secretion, matrix localization, and activation. It forms latent complexes with TGF-beta by covalently binding the TGF-beta propeptide (LAP) via disulfide bonds in the endoplasmic reticulum. This complex is then secreted and targeted to the extracellular matrix, where TGF-beta can be activated by various mechanism

Loading...
||
New chat Able
正在加载,请稍候...