LTBP1 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

• 

  WB analysis using 85820-1-RR (same clone as 85820-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85820-1-RR (LTBP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85820-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP02129-1

  Cytometric bead array standard curve of MP02129-1, LTBP1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85820-1-PBS. Detection antibody: 85820-3-PBS. Standard: Ag25392. Range: 0.313-40 ng/mL.

• 

  Cytometric bead array standard curve of MP02129-2

  Cytometric bead array standard curve of MP02129-2, LTBP1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85820-2-PBS. Detection antibody: 85820-1-PBS. Standard: Ag25392. Range: 0.625-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 85820-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85820-1-RR against Human LTBP1 were performed. The affinity constant is 9.63 nM.

LTBP1 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 85820-1-PBS

Clone No.250127A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

Latent-transforming growth factor beta-binding protein 1, LTBP 1, TGF beta1 BP 1, TGF-beta1-BP-1, Transforming growth factor beta-1-binding protein 1

---

Product Information

85820-1-PBS targets LTBP1 as part of a matched antibody pair:

MP02129-1: 85820-1-PBS capture and 85820-3-PBS detection (validated in Cytometric bead array)

MP02129-2: 85820-2-PBS capture and 85820-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25392

  Product name: Recombinant human LTBP1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 600-739 aa of BC130289

  Sequence: CSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCH

• Full Name: latent transforming growth factor beta binding protein 1
• Calculated Molecular Weight: 1721 aa, 187 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC130289
• Gene Symbol: LTBP1
• Gene ID (NCBI): 4052
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14766
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Latent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) is a large extracellular matrix protein that belongs to the latent TGF-beta binding protein family. It plays a crucial role in the regulation of TGF-beta, a multifunctional cytokine involved in various cellular processes such as cell growth, differentiation, and immune response. LTBP1 is essential for TGF-beta folding, secretion, matrix localization, and activation. It forms latent complexes with TGF-beta by covalently binding the TGF-beta propeptide (LAP) via disulfide bonds in the endoplasmic reticulum. This complex is then secreted and targeted to the extracellular matrix, where TGF-beta can be activated by various mechanism