LTBP1 Recombinant monoclonal antibody

LTBP1 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85820-1-RR
Clone No.250127A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Latent-transforming growth factor beta-binding protein 1, LTBP 1, TGF beta1 BP 1, TGF-beta1-BP-1, Transforming growth factor beta-1-binding protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85820-1-RR targets LTBP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25392

Product name: Recombinant human LTBP1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 600-739 aa of BC130289

Sequence: CSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCH

Predict reactive species
Full Name latent transforming growth factor beta binding protein 1
Calculated Molecular Weight 1721 aa, 187 kDa
Observed Molecular Weight150 kDa
GenBank Accession NumberBC130289
Gene Symbol LTBP1
Gene ID (NCBI) 4052
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14766
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Latent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) is a large extracellular matrix protein that belongs to the latent TGF-beta binding protein family. It plays a crucial role in the regulation of TGF-beta, a multifunctional cytokine involved in various cellular processes such as cell growth, differentiation, and immune response. LTBP1 is essential for TGF-beta folding, secretion, matrix localization, and activation. It forms latent complexes with TGF-beta by covalently binding the TGF-beta propeptide (LAP) via disulfide bonds in the endoplasmic reticulum. This complex is then secreted and targeted to the extracellular matrix, where TGF-beta can be activated by various mechanism

Protocols

Product Specific Protocols
WB protocol for LTBP1 antibody 85820-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...