LXN Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis of pig brain using 66957-1-Ig (same clone as 66957-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66957-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 66957-1-Ig (same clone as 66957-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66957-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66957-1-Ig (same clone as 66957-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66957-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 66957-1-Ig (same clone as 66957-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66957-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rabbit brain using 66957-1-Ig (same clone as 66957-1-PBS)

  rabbit brain tissue were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66957-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66957-1-Ig (same clone as 66957-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66957-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP50023-1

  Sandwich ELISA standard curve ofMP50023-1, LXN Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66957-1-PBS. Detection antibody: HRP-conjugated 66957-2-PBS. Standard: Ag27922. Range: 0.313-20 ng/mL.

• 

  IHC staining of human heart using 66957-1-Ig (same clone as 66957-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 66957-1-Ig (LXN antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66957-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 66957-1-Ig (same clone as 66957-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 66957-1-Ig (LXN antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66957-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66957-1-Ig (same clone as 66957-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using LXN antibody (66957-1-Ig, Clone: 3E5A5 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66957-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 66957-1-Ig (same clone as 66957-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human LXN (66957-1-Ig, Clone:3E5A5) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 66957-1-PBS in a different storage buffer formulation.

LXN Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA

Cat No. 66957-1-PBS

Clone No.3E5A5

Host / Isotype

Mouse / IgG1

Reactivity

rabbit, pig, human

Applications

WB, IHC, IF/ICC, FC (Intra), Sandwich ELISA, Indirect ELISA

Synonyms

TCI, Protein MUM, Latexin, ECI, 3E5A5

---

Product Information

66957-1-PBS targets LXN as part of a matched antibody pair:

MP50023-1: 66957-1-PBS capture and 66957-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: rabbit, pig, human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27922

  Product name: Recombinant human LXN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-222 aa of BC005346

  Sequence: MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE

• Full Name: latexin
• Calculated Molecular Weight: 222 aa, 26 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC005346
• Gene Symbol: LXN
• Gene ID (NCBI): 56925
• RRID: AB_2882280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BS40
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Latexin, also named as LTXN, LXN, ECI, MUM and TCI, is hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. It may function as a neuroprotective mechanism against tau toxicity.