LXN Monoclonal antibody

• 

  WB analysis of pig brain using 66957-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 66957-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 66957-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66957-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 66957-1-Ig

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rabbit brain using 66957-1-Ig

  rabbit brain tissue were subjected to SDS PAGE followed by western blot with 66957-1-Ig (LXN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 66957-1-Ig

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 66957-1-Ig (LXN antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human heart using 66957-1-Ig

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 66957-1-Ig (LXN antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 66957-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using LXN antibody (66957-1-Ig, Clone: 3E5A5 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  FC experiment of HeLa using 66957-1-Ig

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human LXN (66957-1-Ig, Clone:3E5A5) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

LXN Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 66957-1-Ig

Clone No.3E5A5

Host / Isotype

Mouse / IgG1

Reactivity

human, pig, rabbit

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

3E5A5, ECI, Latexin, Protein MUM, TCI

---

Tested Applications

• Positive WB detected in: pig brain tissue, A549 cells, HEK-293 cells, SH-SY5Y cells, rabbit brain tissue, HeLa cells
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66957-1-Ig targets LXN in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, pig, rabbit samples.

• Tested Reactivity: human, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27922

  Product name: Recombinant human LXN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-222 aa of BC005346

  Sequence: MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE

• Full Name: latexin
• Calculated Molecular Weight: 222 aa, 26 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC005346
• Gene Symbol: LXN
• Gene ID (NCBI): 56925
• RRID: AB_2882280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BS40
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Latexin, also named as LTXN, LXN, ECI, MUM and TCI, is hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. It may function as a neuroprotective mechanism against tau toxicity.