CoraLite® Plus 488-conjugated LXN Monoclonal antibody

• 

  IF Staining of HeLa using CL488-66957

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 488 LXN antibody (CL488-66957, Clone: 3E5A5 ) at dilution of 1:200.

LXN Monoclonal Antibody for IF/ICC

Cat No. CL488-66957

Clone No.3E5A5

Host / Isotype

Mouse / IgG1

Reactivity

Human, Pig, rabbit

Applications

IF/ICC

Synonyms

ECI, latexin, LXN, Protein MUM, TCI

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66957 targets LXN in IF/ICC applications and shows reactivity with Human, Pig, rabbit samples.

• Tested Reactivity: Human, Pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27922

  Product name: Recombinant human LXN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-222 aa of BC005346

  Sequence: MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE

• Full Name: latexin
• Calculated Molecular Weight: 222 aa, 26 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC005346
• Gene Symbol: LXN
• Gene ID (NCBI): 56925
• RRID: AB_3084291
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BS40
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Latexin, also named as LTXN, LXN, ECI, MUM and TCI, is hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. It may function as a neuroprotective mechanism against tau toxicity.