Product Information
31674-1-PBS targets LYRM2 in IP, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36366 Product name: Recombinant human LYRM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-88 aa of BC009782 Sequence: QQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSATEEDTIRMMITQGNMQLKELEKTLALAKS Predict reactive species |
| Full Name | LYR motif containing 2 |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC009782 |
| Gene Symbol | LYRM2 |
| Gene ID (NCBI) | 57226 |
| RRID | AB_3742461 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9NU23 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
LYR motif containing 2 (LYRM2) is an evolutionarily conserved gene which belongs to LYR (leucine-tyrosine-arginine) motif proteins (LYRMs) family. LYRM2 is the one of the top ten most significantly upregulated differentially expressed genes in trabecular osteocytes between osteoporosis and normal controls (PMID: 34252604), which is up-regulated in colorectal cancer and promotes tumor growth both in vivo and in vitro. LYRM2 locates in the mitochondrial inner membrane and matrix (PMID: 31004700).
