CoraLite® Plus 488-conjugated M-cadherin Recombinant monoclonal antibody

M-cadherin Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84440-5
Clone No.241837C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

CDH15, 241837C10, Cadherin 14, Cadherin 15, Cadherin-14

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inH9C2 cells, C2C12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84440-5 targets M-cadherin in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25763

Product name: Recombinant human CDH15 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 151-450 aa of BC008951

Sequence: AFLQEAFTGRVLEGAVPGTYVTRAEATDADDPETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRDEFFMEAIEAVSGVDVGRLEVEDRDLPGSPNWVARFTILEGDPDGQFTIRTDPKTNEGVLSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVATFSARDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQHVLSPASPFLKGGWYR

Predict reactive species
Full Name cadherin 15, type 1, M-cadherin (myotubule)
Calculated Molecular Weight 89 kDa
Observed Molecular Weight90-130 kDa
GenBank Accession NumberBC008951
Gene Symbol M-cadherin
Gene ID (NCBI) 1013
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP55291
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. M-cadherin (muscle cadherin), also known as CDH15 (cadherin-15), is a 124-kDa type I transmembrane glycoprotein that is highly expressed in developing skeletal muscle, satellite cells, and cerebellum (PMID: 9545347; 12052883). It associates with β-catenin and functions as a cell-cell adhesion molecule in a homophilic and specific manner (PMID: 9545347). M-cadherin is part of the myogenic program and may provide a trigger for terminal muscle differentiation (PMID: 1840697).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 M-cadherin antibody CL488-84440-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...