CoraLite® Plus 488-conjugated MAD2L2 Monoclonal antibody

MAD2L2 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67100
Clone No.2A4C2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

FC (Intra)

Mitotic arrest deficient 2-like protein 2, MAD2-like protein 2, MAD2B, MAD2 like protein 2, hREV7

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inK-562 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67100 targets MAD2L2 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28233

Product name: Recombinant human MAD2L2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 2-211 aa of BC015244

Sequence: TTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS

Predict reactive species
Full Name MAD2 mitotic arrest deficient-like 2 (yeast)
Calculated Molecular Weight 211 aa, 24 kDa
Observed Molecular Weight 24 kDa
GenBank Accession NumberBC015244
Gene Symbol MAD2L2
Gene ID (NCBI) 10459
RRIDAB_3084308
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UI95
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MAD family, together with BUB and Mps1,Cdc20k, play roles in the mitotic spindle checkpoint. MAD2L2 is one of the MAD family. It can mediate the second polymerase switching in translation DNA synthesis by mediating the interaction between the error-prone DNA polymerase zeta catalytic subunit REV3L and the inserter polymerase REV1. Through regulation of the JNK-mediate phosphorylation and activation of the transcriptional activator ELK1, MAD2L2 involves in cellular response to DNA damage. Also it has role in the progression of cell cycle and peithelial-mesenchymal transdifferentiation.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 MAD2L2 antibody CL488-67100Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...