Product Information
27573-1-PBS targets MAP7D3 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26082 Product name: Recombinant human MAP7D3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 301-400 aa of NM_001173516 Sequence: ASVDAPPQVNVEVFCNTSMEASPKAGVGMAPEVSTDSFPVVSVDVSPVVSTYDSEMSMDASPELSIEALPKVDLETVPKVSIVASPEASLEAPPEVSLEA Predict reactive species |
| Full Name | MAP7 domain containing 3 |
| Calculated Molecular Weight | 98 kDa |
| Observed Molecular Weight | 125-130 kDa |
| GenBank Accession Number | NM_001173516 |
| Gene Symbol | MAP7D3 |
| Gene ID (NCBI) | 79649 |
| RRID | AB_3742239 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IWC1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
MAP7D3, also known as MDP3, features two coiled-coil regions near its N terminus, followed by a linker region, a MAP7-like domain, and a C-terminal domain. MAP7D3 is a microtubule-binding protein that regulates microtubule assembly and stability. MAP7D3 expression is cell cycle dependent, with lower expression in the G2 phase compared to its expression in the other phases of the cell cycle(PMID: 22142902).
