CoraLite® Plus 488-conjugated MAZ Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-82852-3

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 MAZ antibody (CL488-82852-3, Clone: 1D5 ) at dilution of 1:200, CL594-phalloidin (red).

MAZ Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-82852-3

Clone No.1D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

MAZI, Myc-associated zinc finger protein, Pur 1, PUR1, Pur-1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82852-3 targets MAZ in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15200

  Product name: Recombinant human MAZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC041629

  Sequence: MVPLSLLSVPQLSGAGGGGGEAGAGGGAAAVAAGGVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKG

• Full Name: MYC-associated zinc finger protein (purine-binding transcription factor)
• Calculated Molecular Weight: 477 aa, 49 kDa
• Observed Molecular Weight: 49-51 kDa
• GenBank Accession Number: BC041629
• Gene Symbol: MAZ
• Gene ID (NCBI): 4150
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P56270
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Myc-associated zinc-finger protein (MAZ) is a transcription factor with dual roles in transcription initiation and termination. MAZ can activate the expression of a variety of genes such as the c-Myc, insulin, VEGF, and RAS gene family and the serotonin 1A receptor. MAZ plays a critical role in the progression of various cancers including breast, prostate, liver, and so on. Deregulation of MAZ expression is associated with the progression of pancreatic ductal adenocarcinoma (PDAC)(PMID: 29414775).