MBD3 Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MBD3 Recombinant monoclonal antibody, PBS Only (Detector) (86681-2-PBS)

• 

  WB analysis using 86681-2-RR (same clone as 86681-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86681-2-RR (MBD3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86681-2-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02598-2

  The mean MBD3 concentration was determined to be 43.2 ng/mL in Y79 cell extract based on a 1.1 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02598-2

  Sandwich ELISA standard curve of MP02598-2, Human MBD3 Recombinant Matched Antibody Pair - PBS only. 86681-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag5531. 86681-2-PBS was HRP conjugated as the detection antibody. Range: 97.7-6250 pg/mL.

• 

  IF Staining of HeLa using 86681-2-RR (same clone as 86681-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MBD3 antibody (86681-2-RR, Clone: 250922E11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86681-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02598-1

  The mean MBD3 concentration was determined to be 19.2 ng/mL in Y79 cell extract based on a 1.1 mg/mL extract load, 28.9 ng/mL in HeLa cell extract based on a 1.2 mg/mL extract load, 89.6 ng/mL in HEK-293 cell extract based on a 3.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02598-1

  Cytometric bead array standard curve of MP02598-1, MBD3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86681-3-PBS. Detection antibody: 86681-2-PBS. Standard: Ag5531. Range: 0.781-100 ng/mL.

MBD3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 86681-2-PBS

Clone No.250922E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

MBD 3, Methyl-CpG-binding domain protein 3, Methyl-CpG-binding protein MBD3

---

Product Information

86681-2-PBS targets MBD3 as part of a matched antibody pair:

MP02598-1: 86681-3-PBS capture and 86681-2-PBS detection (validated in Cytometric bead array)

MP02598-2: 86681-4-PBS capture and 86681-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5531

  Product name: Recombinant human MBD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-259 aa of BC043619

  Sequence: MERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV

• Full Name: methyl-CpG binding domain protein 3
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC043619
• Gene Symbol: MBD3
• Gene ID (NCBI): 53615
• RRID: AB_3745051
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95983
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Methyl-CpG-binding domain 3 (Mbd3), a member among the five-MBD protein family, is unique in its ability to specifically recognize 5′-hydroxymethyl-cytosine (5′-hmC), an epigenetic marker that is highly enriched in stem cells and cancer.