MBD3 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MBD3 Recombinant monoclonal antibody (86681-2-RR)

• 

  WB analysis using 86681-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86681-2-RR (MBD3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 86681-2-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using MBD3 antibody (86681-2-RR, Clone: 250922E11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

MBD3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86681-2-RR

Clone No.250922E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

MBD 3, Methyl-CpG-binding domain protein 3, Methyl-CpG-binding protein MBD3

---

Tested Applications

• Positive WB detected in: HeLa cells, COLO 320 cells, Y79 cells, Jurkat cells, MCF-7 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86681-2-RR targets MBD3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5531

  Product name: Recombinant human MBD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-259 aa of BC043619

  Sequence: MERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV

• Full Name: methyl-CpG binding domain protein 3
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC043619
• Gene Symbol: MBD3
• Gene ID (NCBI): 53615
• RRID: AB_3745051
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95983
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Methyl-CpG-binding domain 3 (Mbd3), a member among the five-MBD protein family, is unique in its ability to specifically recognize 5′-hydroxymethyl-cytosine (5′-hmC), an epigenetic marker that is highly enriched in stem cells and cancer.