CoraLite® Plus 488-conjugated MBD3 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated MBD3 Recombinant monoclonal antibody (CL488-86681-2)

• 

  IF Staining of HeLa using CL488-86681-2

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 MBD3 antibody (CL488-86681-2, Clone: 250922E11 ) at dilution of 1:200, CL594-phalloidin (red).

MBD3 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86681-2

Clone No.250922E11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

MBD 3, Methyl-CpG-binding domain protein 3, Methyl-CpG-binding protein MBD3

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86681-2 targets MBD3 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5531

  Product name: Recombinant human MBD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-259 aa of BC043619

  Sequence: MERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV

• Full Name: methyl-CpG binding domain protein 3
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC043619
• Gene Symbol: MBD3
• Gene ID (NCBI): 53615
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95983
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Methyl-CpG-binding domain 3 (Mbd3), a member among the five-MBD protein family, is unique in its ability to specifically recognize 5′-hydroxymethyl-cytosine (5′-hmC), an epigenetic marker that is highly enriched in stem cells and cancer.